FREE SHIPPING on all orders over $100

EASY RETURNS 30-day postage paid returns

10% OFF your first order | Use code: FIRST10

1 2

COG449 (OP449), PP2A activator and SET inhibitor

Regular price: $289.00 USD
Regular price
Sale price: $289.00 USD

Shipping calculated at checkout.

Size 2 mg 10 mg

Description

COG449 (OP449) Peptide – PP2A Activator & SET Inhibitor for Anti-Cancer Research

Product Name: COG449 (OP449)
Synonyms: OP449, SET Inhibitor, PP2A Activator
Sequence:

(Ac-RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL-NH2)-BMOE-(Ac-RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL-NH2)

Molecular Formula: C₄₀₄H₆₉₄N₁₄₂O₇₆S₄
Molecular Weight: 9223 g/mol
CAS Number: Not Available
Purity: >98%
Appearance: White to off-white powder
Application: For research use only
Storage: −20°C (long term), sealed and protected from light and moisture
Shipping: Ambient (domestic); varies for international orders

What is COG449 (OP449)?

COG449, also referred to as OP449, is a synthetic cell-penetrating peptide originally developed by Cognosci, Inc. and later advanced by Oncotide Pharmaceuticals. This research-grade peptide is a SET inhibitor that works by disrupting intracellular interactions critical for tumor survival and progression.

Mechanism of Action

COG449 targets and inhibits the SET oncoprotein, which is known to suppress the activity of protein phosphatase 2A (PP2A a well-established tumor suppressor. By blocking SET, COG449 peptide activates PP2A, potentially restoring its function in downregulating cancer-promoting pathways.

This peptide is being explored for its effects in anti-cancer research, especially in hematologic malignancies and drug-resistant solid tumors.

COG449 OP449 Peptide Benefits

● SET Inhibition: Restores tumor suppressor activity of PP2A

● PP2A Activation: Reactivates cellular control mechanisms over oncogenic signaling

● Enhances Drug Sensitivity: Potentially improves efficacy of tyrosine kinase inhibitors

● Preclinical Tumor Suppression: Shown to inhibit tumor cell proliferation in multiple cancer models

COG449 PP2A Activator Uses in Cancer Research

● Leukemia Studies: Shows promise in suppressing cell viability in AML and CML models

● Lymphoma Research: Investigated for effects in Burkitt’s lymphoma

● Oral Squamous Cell Carcinoma Models: Demonstrates ability to interfere with tumor progression

● Drug Resistance Investigations: Explored in combination therapies targeting tyrosine kinase resistance

Chemical Specifications

Property	Details
Peptide Sequence	(RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL)₂
Molecular Formula	C₄₀₄H₆₉₄N₁₄₂O₇₆S₄
Molecular Weight	9223 g/mol
Purity	>98%
Form	Lyophilized Powder
Color	White to off-white

Buy COG449 PP2A Activator Online

Looking to buy COG449 OP449 peptide online for your laboratory or institution? We supply high-purity COG449 peptide designed for advanced cancer and cell signaling research. Bulk quantities and custom packaging available for academic, biotech, or pharmaceutical research.

Important Note

COG449 is not intended for human or veterinary use. It is strictly for laboratory research purposes. The safety and efficacy in humans have not been established, and it has not received regulatory approval as a therapeutic agent.

Shipping & Returns

🚚 FREE Shipping on orders $100+
📦 Ships within 1-7 business days
🌍 International shipping available
♻️ Eco-friendly, recyclable packaging

💰 30-Day Money-Back Guarantee
Not satisfied? Return it for a full refund—no questions asked. Your satisfaction is our priority.

Hurry, only 8 items left in stock!

Bundle & Save

Complete your routine with these products